PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010134P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 446aa    MW: 49440.7 Da    PI: 4.9904
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010134P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.5e-34231285155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +pr+rWtpeLHe+Fveav++LGGse+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  MELO3C010134P1 231 RPRMRWTPELHEAFVEAVNKLGGSENATPKGVLKLMNVEGLTIYHVKSHLQKYRT 285
                     59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.772228288IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-31229287IPR009057Homeodomain-like
SuperFamilySSF466893.94E-18229285IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24232285IPR006447Myb domain, plants
PfamPF002491.2E-10233284IPR001005SANT/Myb domain
PfamPF143797.0E-24317364IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MSSSYPVLPK PFEDKYPKLP LSFQGSSQSE TMRHPIPRQA PPLVSNSGTV GHLFSSSSGF  60
RNDFPLMQPL SQERNAQFSP FISRSANDGS LLPSHGSSHP EVQSAMVTGN LNENSASWST  120
DTLQDLLDFS ENIPDQNGQD QSMAGVLMSD DQAKRNDWPD WADQFISVDD ALEPNWSEIF  180
SDANAGDPKS EVLKPSSTNF NAPPNETNQV DSLPTVEFHS VSNSLSTSTT RPRMRWTPEL  240
HEAFVEAVNK LGGSENATPK GVLKLMNVEG LTIYHVKSHL QKYRTARYKP ESSEGSSGKK  300
KLNPIEEMKT LDLKTSMGIT EALRLQMEVQ KRLHEQLEIQ RNLQLRIEEQ GKYLQEMFEQ  360
QRKMENKLKT SSSILENMPR DDQPENLEQD HDAAGMSTEN AKAAREDDLL AASRKHKGHE  420
GDAVESGEGN SSPDAKRAKS DATAL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818080.0LN681808.1 Cucumis melo genomic scaffold, anchoredscaffold00012.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443767.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN51e-105PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0A0LY820.0A0A0A0LY82_CUCSA; Uncharacterized protein
STRINGPOPTR_0019s03750.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.26e-99G2-like family protein